Gamma-Synuclein

Product background: Gamma-Synuclein (γ-Synuclein) is a presynaptic protein found to be a major component of Parkinson’s Disease (PD) aggregates and is implicated in the pathogenesis of PD and related neurodegenerative disorders.

About the product: Expressed recombinantly in E. coli, human Gamma-Synuclein is purified to our highest standards to ensure batch to batch consistency in both purity and quality.

Applications: The Gamma-Synuclein is sold in 20mM Tris, 100mM NaCl, pH 7.4 to ensure a highly monomeric starting material that could be suited to aggregation studies, seeding experiments, molecular standards, and more.

Catalog ID: S-1007

$300.00 – $500.00

Download Specs Download Datasheet

  • Product Details
    • Physical State: White lyophilized powder
    • Temperature Storage: -20°C
    • Temperature Shipping: Ambient
    • Sequence:
      MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAEEAQSGGD
    • Source: Recombinant. A DNA sequence encoding the human gamma-synuclein sequence was expressed in E. coli.
    • Purity: >95% by SDS-PAGE and Mass Spec.
    • Molecular Mass: 13,300 Da theoretical

  • References

    1. Pan, Z., et al., (2002) J. Biol. Chem. 277 : 35050
    2. Bruening, W., et al., (2000) Cancer 88 : 2154
    3. Ji, H., et al., (1997) Cancer Res. 57 : 759

  • Publications

    Autoimmune antibody decline in Parkinson’s disease and Multiple System Atrophy; a step towards immunotherapeutic strategies.

    BioMedCentral; https://doi.org/10.1186/s13024-017-0187-7.

    Tomasz Brudek, Kristian Winge, Jonas Folke, Søren Christensen, Karina Fog, Bente Pakkenberg and Lars Østergaard Pedersen

Related products