Alpha-Synuclein, S9C Mutant
This human alpha-synuclein (α-Synuclein) contain a mutation at S9C that can be used for thiol coupling or thiol modification. The S9C mutant is compatible with haloalkyl derivatives, maleimides, and sulfonates. Possible applications include fluorescence labeling 1, spin labeling for EPR 2, or PRE experiments 3.
$300.00 – $500.00
-
Product Details
- Physical State: White lyophilized powder
- Temperature Storage: -20°C
- Temperature Shipping: Ambient
- Sequence:
MDVFMKGLC KAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
- Source: Recombinant. A DNA sequence encoding the human alpha-synuclein mutant S9C, was expressed in E. coli
- Purity: >95% by SDS-PAGE
- Molecular Mass: 14,480 Da theoretical
-
References
1. Daniels, M.J., et al., (2019) Sci Rep 9 : 2937
2. Drescher, M., et al., (2008) Chembiochem. 9(15) : 2411-6
3. Rospigliosi, C.C., et al., (2009) J Mol Biol. 388(5) : 1022-1032
