Alpha-Synuclein, 1-95

Product background: Alpha-Synuclein (α-Synuclein) is a presynaptic protein found to be a major component of Parkinson’s Disease (PD) aggregates and is implicated in the pathogenesis of PD and related neurodegenerative disorders.

About the product: Expressed recombinantly in E. coli, human Alpha-Synuclein 1-95 is purified to our highest standards to ensure batch-to-batch consistency in both purity and quality.

Applications: Human Alpha-Synuclein 1-95 is sold in 20mM Tris, 100mM NaCl, pH 7.4 to ensure a highly monomeric starting material that may be suited to aggregation studies, seeding experiments, molecular standards, and more.

Catalog ID: S-1012-1

$300.00

  • Product Details

    • Size: 0.5 mg
    • Physical State: White lyophilized powder
    • Temperature Storage: -20°C
    • Temperature Shipping: Ambient
    • Sequence:
      MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFV
    • Source: Recombinant. A DNA sequence encoding the human alpha-synuclein (1-95) sequence was expressed in E. coli.
    • Purity: >95% by SDS-PAGE
    • Molecular Mass: 9,391 Da theoretical
  • References

    1. Conway, K., et al., (2000) Biochemistry, 39 : 2552
    2. Jakes, R., et al., (1994) FEBS Letters, 345 : 27
    3. Masliah, E., et al., (2001) Proc. Natl. Acad. Sci., USA, 98 : 12245
    4. Ueda, K., et al., (1993) Proc. Natl. Acad. Sci., USA, 90 : 11282
    5. Grozdanov, V., et al., (2019) Ann Neurol, 86(4) : 593-606