Alpha-Synuclein, 61-140

Alpha-Synuclein (α-Synuclein) is a 14 kD (140 amino acids) acidic presynaptic protein and is a major component of Parkinson’s Disease (PD) aggregates. α-Synuclein is implicated in the pathogenesis of PD and related neurodegenerative disorders. α-Synuclein also accumulates in the brains of sporadic PD patients as a major component of Lewy bodies, which are intraneuronal cytoplasmic inclusions characteristic of PD. α-Synuclein appears to associate with other proteins that aggregate and is found in beta-amyloid plaques and neuritic tangles in Alzheimer’s disease 3. rPeptide offers a wide array of synuclein products, including fragments, mutants, preformed fibrils, and labeled versions in addition to the wild-type protein. A deletion mutant of α-synuclein (amino acids 61-140). Additional amino acid (Met) is attached at the N-terminus.

Catalog ID: S-1013-1

$300.00

Download Specs Download Datasheet

  • Product Details
    • Size: 0.5 mg
    • Physical State: White lyophilized powder
    • Temperature Storage: -20°C
    • Temperature Shipping: Ambient
    • Sequence:
      MEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
    • Source: Recombinant. A DNA sequence encoding the human alpha-synuclein (61-140) sequence was expressed in E. coli. Additional amino acid(Met) is attached at the N-terminus.
    • Purity: >95% by SDS-PAGE
    • Molecular Mass: 8,460 Da theoretical

  • References

    1. Conway, K., et al., (2000) Biochemistry, 39 : 2552
    2. Jakes, R., et al., (1994) FEBS Letters, 345 : 27
    3. Masliah, E., et al., (2001) Proc. Natl. Acad. Sci., USA, 98 : 12245
    4. Ueda, K., et al., (1993) Proc. Natl. Acad. Sci., USA, 90 : 11282
    5. Grozdanov, V., et al., (2019) Ann Neurol, 86(4) : 593-606

Related products