Alpha-Synuclein, 61-140
Product background: Alpha-Synuclein (α-Synuclein) is a presynaptic protein found to be a major component of Parkinson’s Disease (PD) aggregates and is implicated in the pathogenesis of PD and related neurodegenerative disorders.
About the product: Expressed recombinantly in E. coli, human Alpha-Synuclein 61-140 is purified to our highest standards to ensure batch-to-batch consistency in both purity and quality.
Applications: Human Alpha-Synuclein 61-140 is sold in 20mM Tris, 100mM NaCl, pH 7.4 to ensure a highly monomeric starting material that may be suited to aggregation studies, seeding experiments, molecular standards, and more.
$300.00
-
Product Details
- Size: 0.5 mg
- Physical State: White lyophilized powder
- Temperature Storage: -20°C
- Temperature Shipping: Ambient
- Sequence:
MEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
- Source: Recombinant. A DNA sequence encoding the human alpha-synuclein (61-140) sequence was expressed in E. coli. Additional amino acid(Met) is attached at the N-terminus.
- Purity: >95% by SDS-PAGE
- Molecular Mass: 8,460 Da theoretical
-
References
1. Conway, K., et al., (2000) Biochemistry, 39 : 2552
2. Jakes, R., et al., (1994) FEBS Letters, 345 : 27
3. Masliah, E., et al., (2001) Proc. Natl. Acad. Sci., USA, 98 : 12245
4. Ueda, K., et al., (1993) Proc. Natl. Acad. Sci., USA, 90 : 11282
5. Grozdanov, V., et al., (2019) Ann Neurol, 86(4) : 593-606