Alpha-Synuclein, S9C Mutant
Product background: Alpha-Synuclein (α-Synuclein) is a presynaptic protein found to be a major component of Parkinson’s Disease (PD) aggregates and is implicated in the pathogenesis of PD and related neurodegenerative disorders.
About the product: Expressed recombinantly in E. coli, human Alpha-Synuclein with the S9C mutation is purified to our highest standards to ensure batch-to-batch consistency in both purity and quality.
Applications: Human Alpha-Synuclein S9C mutant is sold in 20mM Tris, 100mM NaCl, pH 7.4 to ensure a highly monomeric starting material that can be used for thiol coupling or thiol modification. The S9C mutant is compatible with haloalkyl derivatives, maleimides, and sulfonates. Applications include fluorescence labeling, spin labeling for EPR, or PRE experiments.
$300.00 – $500.00
-
Product Details
- Physical State: White lyophilized powder
- Temperature Storage: -20°C
- Temperature Shipping: Ambient
- Sequence:
MDVFMKGLC KAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
- Source: Recombinant. A DNA sequence encoding the human alpha-synuclein mutant S9C, was expressed in E. coli
- Purity: >95% by SDS-PAGE
- Molecular Mass: 14,480 Da theoretical
-
References
1. Daniels, M.J., et al., (2019) Sci Rep 9 : 2937
2. Drescher, M., et al., (2008) Chembiochem. 9(15) : 2411-6
3. Rospigliosi, C.C., et al., (2009) J Mol Biol. 388(5) : 1022-1032