APP 669-711, HCl

Product background: Amyloid Precursor Protein (APP) is a membrane spanning protein that functions as the precursor to Amyloid-Beta in plaques of Alzheimer’s Disease patients. The extra cellular region is proteolytically cleaved to release amyloid peptides.

About the product: Expressed recombinantly in E. coli, APP 669-711 is purified to our highest standards to ensure batch-to-batch consistency in both purity and quality.

Applications: The HCl counter-ion is lyophilized in an acidic environment, which some consider to be more physiologically relevant and less toxic. It also ensures a highly monomeric starting material that may be suited to aggregation studies, seeding experiments, molecular standards and more.

Catalog ID: AP-1156

$550.00$950.00

  • Product Details

    • Physical State: White lyophilized powder
    • Temperature Storage: -20°C
    • Temperature Shipping: Ambient
    • Sequence:
      VKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
    • Source: Recombinant. A DNA sequence encoding the human APP669-711 sequence was expressed in E. coli
    • Purity: >97% by Mass Spec.
    • Molecular Mass: 4,688 Da theoretical
  • References

    1. Dawkins, et al., (2014) J Neurochem., 129 (5) : 756-769
    2. Nakamura, et al., (2018) Nature, 554 (7691) : 249-254