APP 669-711, HFIP
Product background: Amyloid precursor protein (APP) is a membrane spanning protein that functions as the precursor to amyloid beta in plaques of Alzheimer’s disease patients. The extra cellular region is proteolytically cleaved to release amyloid peptides.
About the product: Expressed recombinantly in E. coli, APP 669-711 is purified to our highest standards to ensure batch to batch consistency in both purity and quality.
Applications: The HFIP counter ion ensues a highly monomeric starting material that could be suited to aggregation studies, seeding experiments, molecular standards and more.
$550.00
-
Product Details
- Size: 0.5 mg
- Physical State: Clear, dry film
- Temperature Storage: -20°C
- Temperature Shipping: Ambient
- Sequence:VKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
- Source: Recombinant. A DNA sequence encoding the human APP669-711 sequence was expressed in E. coli
- Purity: >97% by Mass Spec.
- Molecular Mass: 4,688 Da theoretical
-
References
1. Dawkins, et al., (2014) J Neurochem., 129 (5) : 756-769
2. Nakamura, et al., (2018) Nature, 554 (7691) : 249-254
