APP 669-711, NaOH
Product background: Amyloid Precursor Protein (APP) is a membrane spanning protein that functions as the precursor to Amyloid-Beta in plaques of Alzheimer’s Disease patients. The extra cellular region is proteolytically cleaved to release amyloid peptides.
About the product: Expressed recombinantly in E. coli, APP 669-711 is purified to our highest standards to ensure batch-to-batch consistency in both purity and quality.
Applications: The NaOH counter-ion is lyophilized in a basic environment, which some consider to be more physiologically relevant and less toxic. It also ensures a highly monomeric starting material that may be suited to aggregation studies, seeding experiments, molecular standards and more.
$550.00 – $950.00
-
Product Details
- Physical State: White lyophilized powder
- Temperature Storage: -20°C
- Temperature Shipping: Ambient
- Sequence:
VKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
- Source: Recombinant. A DNA sequence encoding the human APP669-711 sequence was expressed in E. coli
- Purity: >97% by Mass Spec.
- Molecular Mass: 4,688 Da theoretical
-
References
