Chemokine CXCL-12 (SDF1-α)
Product background: Chemokines are secreted proteins that regulate and activate the immune system through chemotaxis. Dysfunction or deregulation of chemokines can be key factors in neurodegeneration or neuroinflammation.
About the product: Expressed recombinantly in E. coli, human CXCL-12 is purified to our highest standards to ensure batch-to-batch consistency in both purity and quality. The activity of the human CXCL-12 is shown through a cell migration assay.
Applications: Human CXCL-12 is sold as a lyophilized powder in 20mM Tris pH 7.4. Possible applications include chemotaxis assay, inflammation studies, or as a biological standard.
$225.00 – $1,999.00
-
Product Details
- Physical State: White lyophilized powder
- Temperature Storage: -20°C
- Temperature Shipping: Ambient
- Sequence:
KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQI VARLKNNNRQVCIDPKLKWIQEYLEKALNK
- Source: Recombinant. A DNA sequence encoding the human CXCL-12 (SDF1-α) sequence was expressed in E. coli
- Purity: >95% by SDS-PAGE
- Molecular Mass: 7,963 Da theoretical
-
References
1. Oppenheim, J.J, et al., (1991) Annu Rev Immunol., 9 : 617-648
2. DeVries, M.E., et al., (2006) J Immunol., 176(1) : 401-415.
