Chemokine CXCL-12 (SDF1-α)
Chemokines attract immune cells to sites of inflammation 1. In addition, chemokine signaling recruits neurons and other cells to specific sites during metastasis. The most conserved chemokine ligand/receptor signaling pathway is CXCL12/CXCR4/CXCR7. 2.Therefore, the receptor CXCL12 has been produced as a new product at rPeptide and represents chemokines in the study of neurodegenerative diseases. Since chemokines have a role in inflammatory cell attraction, the function of neuroprotection in Alzheimer’s disease is an active area of investigation.
$225.00 – $1,999.00
-
Product Details
- Physical State: White lyophilized powder
- Temperature Storage: -20°C
- Temperature Shipping: Ambient
- Sequence:
KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQI VARLKNNNRQVCIDPKLKWIQEYLEKALNK
- Source: Recombinant. A DNA sequence encoding the human CXCL-12 (SDF1-α) sequence was expressed in E. coli
- Purity: >95% by SDS-PAGE
- Molecular Mass: 7,963 Da theoretical
-
References
1. Oppenheim, J.J, et al., (1991) Annu Rev Immunol., 9 : 617-648
2. DeVries, M.E., et al., (2006) J Immunol., 176(1) : 401-415.
