Gamma-Synuclein, Mouse

Product background: Gamma-Synuclein (γ-Synuclein) is a presynaptic protein found to be a major component of Parkinson’s Disease (PD) aggregates and is implicated in the pathogenesis of PD and related neurodegenerative disorders.

About the product: Expressed recombinantly in E. coli, mouse Gamma-Synuclein is purified to our highest standards to ensure batch to batch consistency in both purity and quality.

Applications: The mouse Gamma-Synuclein is sold in 20mM Tris, 100mM NaCl, pH 7.4 to ensure a highly monomeric starting material that could be suited to aggregation studies, seeding experiments, molecular standards, and more.

Catalog ID: S-1009

$300.00$500.00

  • Product Details

    • Physical State: White lyophilized powder
    • Temperature Storage: -20°C
    • Temperature Shipping: Ambient
    • Sequence:
      MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGTKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVANKTVEEAENIVVTTGVVRKEDLEPPAQDQEAKEQEENEE
    • Source: Recombinant. A DNA sequence encoding the mouse gamma-synuclein sequence was expressed in E. coli.
    • Purity: >95% by SDS-PAGE and Mass Spec.
    • Molecular Mass: 13,300 Da theoretical