Gamma-Synuclein, Mouse
Product background: Gamma-Synuclein (γ-Synuclein) is a presynaptic protein found to be a major component of Parkinson’s Disease (PD) aggregates and is implicated in the pathogenesis of PD and related neurodegenerative disorders.
About the product: Expressed recombinantly in E. coli, mouse Gamma-Synuclein is purified to our highest standards to ensure batch to batch consistency in both purity and quality.
Applications: The mouse Gamma-Synuclein is sold in 20mM Tris, 100mM NaCl, pH 7.4 to ensure a highly monomeric starting material that could be suited to aggregation studies, seeding experiments, molecular standards, and more.
$300.00 – $500.00
-
Product Details
- Physical State: White lyophilized powder
- Temperature Storage: -20°C
- Temperature Shipping: Ambient
- Sequence:
MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGTKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVANKTVEEAENIVVTTGVVRKEDLEPPAQDQEAKEQEENEE
- Source: Recombinant. A DNA sequence encoding the mouse gamma-synuclein sequence was expressed in E. coli.
- Purity: >95% by SDS-PAGE and Mass Spec.
- Molecular Mass: 13,300 Da theoretical
-
References
