Tau-383, S262A Mutant
Product background: The Tau proteins are a family of neuronal microtubule associated proteins that are found in the neurofibrillary tangles often associated with Alzheimer’s Disease. Tau promotes the assembly and maintains the structure of microtubules in neuronal cells.
About the product: Tau-383 is a splicing variant human Tau with 383 amino acids with a mutation S262A, containing no N-terminal repeats and 4 microtubule binding regions (0N4R). Expressed recombinantly in E. coli, this Tau-383 mutant is purified to our highest standards to ensure batch-to-batch consistency in both purity and quality.
Applications: rPeptide Tau products can be used for a wide variety of applications including aggregation studies, assay development, fibrillization, and as standards in customer Analyses.
$300.00
-
Product Details
- Size: 50 µg
- Physical State: White lyophilized powder
- Temperature Storage: -20°C
- Temperature Shipping: Ambient
- Sequence:
MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVT
- Source: Recombinant, in E. coli. No his-tag.
- Purity: >90% by SDS-PAGE
- Molecular Mass: 39,990 Da theoretical
-
References
1. Avila, J., et al., (2004) Physiol Rev., 84 : 361
2. Goedert, M., (1993) Trends Neurosci., 16 : 460
3. Mandelkow, E., et al., (1996) Ann N Y Acad Sci., 777 : 96
4. Goedert, M., et al., (1989) Neuron., 3 : 519
5. Himmler, et al., (1989) Mol Cell Biol., 9 : 1381
6. Tai, C., et al., (2020) Neuron., 106(3) : 421-437.e11
7. Nobuhara, C., et al., (2017) Am J Pathol., 187(6) : 1399–1412